APOBEC3B Rabbit Polyclonal Antibody

• Catalog Number: orb579676
• Category: Antibodies
• Description: Rabbit polyclonal antibody to APOBEC3B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: APOBEC3B
• UniProt ID: Q9UH17
• Protein Sequence: Synthetic peptide located within the following region: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW
• NCBI: NP_004891
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: A3B, ARP4, ARCD3, PHRBNL, APOBEC1L, bK150C2.2, DJ7
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Positive control (+): Human Lung (LU), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 3 ug/ml.

WB Suggested Anti-APOBEC3B Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.