APEH Rabbit Polyclonal Antibody

• Catalog Number: orb580319
• Category: Antibodies
• Description: Rabbit polyclonal antibody to APEH
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APEH
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 81kDa
• Target: APEH
• UniProt ID: P13798
• Protein Sequence: Synthetic peptide located within the following region: VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR
• NCBI: NP_001631
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: APH, OPH, AARE, ACPH, D3S48E, D3F15S2, DNF15S2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

APEH was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb580319 with 1:200 dilution. Western blot was performed using orb580319 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: APEH IP with orb580319 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Rabbit Anti-APEH Antibody, Catalog Number: orb580319, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-APEH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. APEH is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-APEH antibody Titration: 1 ug/ml, Sample Type: Human liver.