You have no items in your shopping cart.
Cart summary
Anti-SARS-CoV-2 NSP3 Antibody
Catalog Number: orb2602797
| Catalog Number | orb2602797 |
|---|---|
| Category | Antibodies |
| Description | Anti-SARS-CoV-2 NSP3 Antibody. Tested in ELISA applications. This antibody reacts with Human. |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | ELISA |
| Reactivity | Human |
| Isotype | Rabbit IgG |
| Immunogen | HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK |
| Antibody Type | Primary Antibody |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
| Form/Appearance | Lyophilized |
| Conjugation | APC |
| MW | 140 kDa, 130 kDa, 110 kDa |
| UniProt ID | P0DTD1, P0DTC1 |
| Storage | Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles. |
| Alternative names | Replicase polyprotein 1ab; pp1ab; ORF1ab polyprote Read more... |
| Note | For research use only |
| Application notes | ELISA, 0.001-0.1μg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml |
| Expiration Date | 12 months from date of receipt. |
