You have no items in your shopping cart.
Cart summary
| Catalog Number | orb738429 |
|---|---|
| Category | Antibodies |
| Description | Anti-SARS-CoV-2 NSP3 Antibody. Tested in ELISA applications. This antibody reacts with Human. |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | ELISA |
| Reactivity | Human |
| Isotype | Rabbit IgG |
| Immunogen | HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK |
| Antibody Type | Primary Antibody |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
| Form/Appearance | Lyophilized |
| Conjugation | Unconjugated |
| MW | 140 kDa, 130 kDa, 110 kDa |
| UniProt ID | P0DTD1, P0DTC1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | Replicase polyprotein 1ab; pp1ab; ORF1ab polyprote Read more... |
| Note | For research use only |
| Application notes | ELISA, 0.001-0.1μg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml |
| Expiration Date | 12 months from date of receipt. |
Filter by Applications
Peter E Cockram 1 2, Benjamin T Walters 3, Aaron Lictao 3, Frances Shanahan 2, Ingrid E Wertz 2, Scott A Foster 2, Joachim Rudolph Allosteric Inhibitors of the SARS-COV-2 Papain-like Protease Domain Induce Proteasomal Degradation of Its Parent Protein NSP3 ACS Chem Biol, (2024)
Applications
WB
