SARS-CoV-2 NSP3 Antibody

• Catalog Number: orb738429
• Category: Antibodies
• Description: Anti-SARS-CoV-2 NSP3 Antibody. Tested in ELISA applications. This antibody reacts with Human.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Isotype: Rabbit IgG
• Conjugation: Unconjugated
• Reactivity: Human
• Form/Appearance: Lyophilized
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Purification: Immunogen affinity purified.
• Immunogen: HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK
• UniProt ID: P0DTD1, P0DTC1
• MW: 140 kDa, 130 kDa, 110 kDa
• Tested applications: ELISA
• Application notes: ELISA, 0.001-0.1μg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Replicase polyprotein 1ab; pp1ab; ORF1ab polyprote
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

Peter E Cockram 1 2, Benjamin T Walters 3, Aaron Lictao 3, Frances Shanahan 2, Ingrid E Wertz 2, Scott A Foster 2, Joachim Rudolph Allosteric Inhibitors of the SARS-COV-2 Papain-like Protease Domain Induce Proteasomal Degradation of Its Parent Protein NSP3 ACS Chem Biol, (2024)

PubMed: 38150587

Applications

WB