Anti-Caspase 8/CASP8 Antibody

• Catalog Number: orb1728223
• Category: Antibodies
• Description: 0
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Caspase 8 (410-449aa VSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYE), different from the related mouse and rat sequences by seven amino acids.
• Dilution range: Western blot, 0.1-0.5 μg/ml, Human, Mouse, Rat Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/ml, Human, Mouse, Rat, By Heat Immunohistochemistry(Frozen Section), 0.5-1 μg/ml, Human Immunocytochemistry, 0.5-1 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 55391 MW
• UniProt ID: Q14790
• Storage: At -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freezing and thawing.
• Alternative names: CAP4, MACH, MCH5, FLICE, ALPS2B, Casp-8, Caspase-8
• Note: For research use only
• Application notes: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of PC-3 cells using anti-CASP8 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of HeLa cells using anti-CASP8 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of Caspase8 using anti-Caspase8 antibody.Lane 1:rat liver tissue;2:mouse liver tissue;3:HEPG2 cell.

IHC analysis of Caspase8 using anti-Caspase8 antibody. Caspase8 was detected in paraffin-embedded section of mouse spleen tissues.

IHC analysis of Caspase8 using anti-Caspase8 antibody. Caspase8 was detected in paraffin-embedded section of rat intestine tissues.

IHC analysis of Caspase8 using anti-Caspase8 antibody. Caspase8 was detected in paraffin-embedded section of rat spleen tissues.

IHC analysis of Caspase8 using anti-Caspase8 antibody. Caspase8 was detected in paraffin-embedded section of human intestinal cancer tissues.

IHC analysis of Caspase8 using anti-Caspase8 antibody. Caspase8 was detected in paraffin-embedded section of human mammary cancer tissues.