You have no items in your shopping cart.
Featured
Description
Research Area
Epigenetics, Neuroscience
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Baculovirus |
|---|---|
| Biological Origin | Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 1-66aa |
| Protein Length | Full Length |
| MW | 10.7 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | VRDGYIAKPENCAHHCFPGSSGCDTLCKENGGTGGHCGFKVGHGTACWCNALPDKVGIIVDGVKCH |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Lqh VII (LqhVII)
Similar Products
−Animal Alpha-like toxin Lqh7 protein [orb624057]
Greater than 85% as determined by SDS-PAGE.
11.8 kDa
E.coli
20 μg, 1 mg, 100 μgAnimal Lqh7 protein [orb624136]
Greater than 90% as determined by SDS-PAGE.
8.8 kDa
Yeast
100 μg, 20 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide


