Animal Carcinoscorpius rotundicauda Limulus clotting factor C protein

SKU: orb605490

Description

This Animal Carcinoscorpius rotundicauda Limulus clotting factor C protein spans the amino acid sequence from region 691-1019aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Epigenetics

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: Yeast
• Biological Origin: Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda)
• Tag: N-terminal 10xHis-tagged
• Molecular Weight: 39.2 kDa
• Expression Region: 691-1019aa
• Protein Length: Partial
• Protein Sequence: SSQPSTVDLASKVKLPEGHYRVGSRAIYTCESRYYELLGSQGRRCDSNGNWSGRPASCIPVCGRSDSPRSPFIWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPNQFKMYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSETIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI
• Purity: Greater than 85% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

Limulus clotting factor C, FC, EC 3.4.21.84) [Cleaved into, Limulus clotting factor C heavy chain, Limulus clotting factor C light chain, Limulus clotting factor C chain A, Limulus clotting factor C chain B]

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda).

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda).

Quick Database Links

UniProt

Q26422