Amylin (IAPP)(Feline)

SKU: orb2693388

Description

Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion.

Images & Validation

−

Key Properties

−

Target	Amylin Receptor
Molecular Weight	3910.45
Protein Sequence	KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)
Purity	≥95%

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Amylin Receptor

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols