You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582945 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AMIGO3 |
Target | AMIGO3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Guinea pig |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AMIGO3 |
Protein Sequence | Synthetic peptide located within the following region: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL |
UniProt ID | Q86WK7 |
MW | 55 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ALI3, AMIGO-3 |
Research Area | Cell Biology, Signal Transduction |
Note | For research use only |
NCBI | NP_942015 |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
WB Suggested Anti-AMIGO3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.
ELISA, ICC, IHC-Fr | |
Porcine | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Guinea pig, Human | |
Rabbit | |
Polyclonal | |
FITC |