Cart summary

You have no items in your shopping cart.

AMIGO3 Rabbit Polyclonal Antibody (HRP)

AMIGO3 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2104277

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2104277
CategoryAntibodies
DescriptionAMIGO3 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityGuinea pig, Human
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AMIGO3
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW55kDa
UniProt IDQ86WK7
Protein SequenceSynthetic peptide located within the following region: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL
NCBINP_942015
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesALI3, AMIGO-3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.