AMBP Rabbit Polyclonal Antibody

• Catalog Number: orb584240
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UTI
• Target: AMBP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMBP
• Protein Sequence: Synthetic peptide located within the following region: VCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFS
• UniProt ID: P02760
• MW: 39kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: A1M, HCP, ITI, UTI, EDC1, HI30, ITIL, IATIL, ITILC
• Note: For research use only
• NCBI: NP_001624

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. AMBP is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. AMBP is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-AMBP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.