Ambp Rabbit Polyclonal Antibody

• Catalog Number: orb578291
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UTI
• Target: Ambp
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Protein Sequence: Synthetic peptide located within the following region: ATLESYVVHTNYDEYAIFLTKKFSHRHGPTITAKLYGREPQLRDSLLQEF
• UniProt ID: Q64240
• MW: 39 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: UTI
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_037033

25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The 39 kDa protein is modified by glycosylation which may result in a shift in molecular weight on gels. Recommended dilution for this antibody is 1-3 ug/ml.

WB Suggested Anti-Ambp Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Rat Lung.