You have no items in your shopping cart.
Description
Research Area
Neuroscience
Images & Validation
−
Key Properties
−| Source | Protein expressed in Escherichia coli. |
|---|---|
| MW | 14486Da |
| Purity | 95% by Chromatography and SDS-PAGE |
| Protein Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAPGKTKEGVLYVGSKTKEGVVHGVAT VAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQ EGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Storage & Handling
−| Storage | Room temperature, avoid light exposure. |
|---|---|
| Form/Appearance | Lyophilized 1 mg/vial |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Human SNCA A30P Protein [orb428501]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
10 μg, 50 μg, 1 mgHuman SNCA A30P/A53T Protein [orb169309]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
10 μg, 50 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide