ALOX15 Rabbit Polyclonal Antibody

• Catalog Number: orb330818
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ALOX15
• Target: ALOX15
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALOX15
• Protein Sequence: Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL
• UniProt ID: P16050
• MW: 73kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Anti-15 LOX antibody, anti-15-LOX antibody, anti-1
• Note: For research use only
• NCBI: NP_001131

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-ALOX15 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.