ALOX15 Rabbit Polyclonal Antibody

SKU: orb330818

Description

Rabbit polyclonal antibody to ALOX15

Research Area

Metabolism Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALOX15
• Target: ALOX15
• Protein Sequence: Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL
• Molecular Weight: 73kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Anti-15 LOX antibody, anti-15-LOX antibody, anti-15LOX1 antibody, anti-15ALOX antibody, anti-Arachidonate 15 lipoxygenase antibody, anti-Arachidonate 15-lipoxygenase antibody, anti-Arachidonate omega 6 lipoxygenase antibody, anti-Arachidonate omega-6 lipoxygenase antibody, anti-15 LOX_HUMAN antibody, anti-15 LIPOXYGENASE RETICULOCYTE ARACHIDONATE. antibody

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-ALOX15 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.

Quick Database Links

Gene Symbol

ALOX15

UniProt

P16050

RefSeq (Protein):NP_001131