AHR Rabbit Polyclonal Antibody

• Catalog Number: orb574098
• Category: Antibodies
• Description: AHR is a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AHR
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 96kDa
• Target: AHR
• UniProt ID: P35869
• Protein Sequence: Synthetic peptide located within the following region: RAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVL
• NCBI: NP_001612
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RP85, bHLHe76
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 5.0 ug/ml. Peptide Concentration: 2.0 ug/ml. Lysate Quantity: 25 ug/lane, Gel Concentration: 6%-18%.

Human kidney

WB Suggested Anti-AHR Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.