AHR Rabbit Polyclonal Antibody

• Catalog Number: orb573872
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AHR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AHR
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 96kDa
• Target: AHR
• UniProt ID: P35869
• Protein Sequence: Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL
• NCBI: NP_001612
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RP85, bHLHe76
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

AHR antibody - N-terminal region (orb573872) validated by WB using Human HepG2 Lysate at 2.5 ug/ml, 5 ug/ml.

Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): A549 (N03), Negative control (-): THP-1 (N30), Antibody concentration: 5 ug/ml.

Lanes: Lane 1: 50 ug HepG2 nuclei extract + benzo[a]pyrene, Lane 2: 50 ug HepG2 cytoplasm extract + benzo[a]pyrene, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:1000, Gene Name: AHR (Arylhydrocarbon receptor).

Rabbit Anti-AHR Antibody, Catalog Number: orb573872, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-AHR Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Placenta.