You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| CAS Number | 159899-65-7 |
| MW | 3576.06 |
| Purity | ≥95% |
| Formula | C159H252N46O48 |
| Protein Sequence | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−Adrenomedullin (AM) (22-52), human acetate [orb1679769]
99.42% (May vary between batches)
3636.09
100 mg, 200 mg, 1 mg, 5 mg, 50 mg, 10 mg, 25 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
others
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Adrenomedullin (22-52), human (orb2694145)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review