Cart summary

You have no items in your shopping cart.

ADRB1 Rabbit Polyclonal Antibody

Catalog Number: orb329873

DispatchUsually dispatched within 1 - 2 weeks
$ 600.00
Catalog Numberorb329873
CategoryAntibodies
DescriptionRabbit polyclonal antibody to beta 1 Adrenergic Receptor
TargetADRB1
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman
Predicted ReactivityCanine, Guinea pig, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ADRB1
Protein SequenceSynthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
UniProt IDP08588
MW51 kDa
Tested applicationsWB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesanti-ADR B1 antibody, anti-ADRB 1 antibody, anti-A
Read more...
NoteFor research use only
NCBINP_000675
ADRB1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

ADRB1 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Positive control (+): Mouse liver (M-LI), Negative control (-): Mouse spleen (M-SP), Antibody concentration: 1 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/mL. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.

ADRB1 Rabbit Polyclonal Antibody

WB Suggested Anti-ADRB1 Antibody, Positive Control: Lane 1: 20 ug Wild type mouse, left ventricle Lane 2: 20 ug Transgenic mouse, treated with experimental drug, left ventricle Lane 3: 20 ug HepG2 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti rabbit-HRP, Secondry Antibody Dilution: 1:5000.

ADRB1 Rabbit Polyclonal Antibody

WB Suggested Anti-ADRB1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.

  • ADRB1 Rabbit Polyclonal Antibody [orb501003]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • ADRB1 Rabbit Polyclonal Antibody [orb312831]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Anti-Beta-1 Adrenergic Receptor Antibody [orb318975]

    IF,  IH,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 30 μl
  • AR-β1 rabbit pAb [orb764587]

    ELISA,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • ADRB1 Rabbit Polyclonal Antibody (FITC) [orb466967]

    FC,  IF

    Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl