Cart summary

You have no items in your shopping cart.

ADRB1 Rabbit Polyclonal Antibody

SKU: orb329873

Description

Rabbit polyclonal antibody to beta 1 Adrenergic Receptor

Research Area

Cardiovascular Research, Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityCanine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ADRB1
TargetADRB1
Protein SequenceSynthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
Molecular Weight51 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti-ADR B1 antibody, anti-ADRB 1 antibody, anti-ADRB1 antibody, anti-ADRB1R antibody, anti-Adrenergic beta 1 receptor antibody, anti-Adrenoceptor beta 1 antibody, anti-B1AR antibody, anti-beta 1 adrenoceptor antibody, anti-beta 1 adrenoreceptor antibody, anti-beta-1 adrenergic receptor antibody, anti-beta-1 adrenoceptor antibody, anti-beta-1 adrenoreceptor antibody, anti-beta1AR antibody, anti-RHR antibody

Similar Products

  • ADRB1 Rabbit Polyclonal Antibody [orb501003]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • ADRB1 Rabbit Polyclonal Antibody [orb312831]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • AR-β1 rabbit pAb Antibody [orb764587]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • ADRB1 Rabbit Polyclonal Antibody (FITC) [orb466967]

    FC,  IF

    Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
  • ADRB1 Antibody [orb670550]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ADRB1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

ADRB1 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Positive control (+): Mouse liver (M-LI), Negative control (-): Mouse spleen (M-SP), Antibody concentration: 1 ug/mL.

ADRB1 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/mL. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.

ADRB1 Rabbit Polyclonal Antibody

WB Suggested Anti-ADRB1 Antibody, Positive Control: Lane 1: 20 ug Wild type mouse, left ventricle Lane 2: 20 ug Transgenic mouse, treated with experimental drug, left ventricle Lane 3: 20 ug HepG2 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti rabbit-HRP, Secondry Antibody Dilution: 1:5000.

ADRB1 Rabbit Polyclonal Antibody

WB Suggested Anti-ADRB1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000675

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ADRB1 Rabbit Polyclonal Antibody (orb329873)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry