Cart summary

You have no items in your shopping cart.

ACTN1 Rabbit Polyclonal Antibody

SKU: orb583986

Description

Rabbit polyclonal antibody to ACTN1

Research Area

Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ACTN1
TargetACTN1
Protein SequenceSynthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
Molecular Weight103kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

BDPLT15

Similar Products

  • Actinin-α1/2/3/4 rabbit pAb Antibody [orb764468]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Actinin-α1 rabbit pAb Antibody [orb770735]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Actinin-α1/2/3/4 Polyclonal Antibody [orb1414760]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • ACTN1 Antibody (N-term) [orb39198]

    FC,  IHC-P,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
  • ACTN1/ACTN2/ACTN3/ACTN4 Antibody [orb675297]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ACTN1 Rabbit Polyclonal Antibody

Sample Type: 1.-4. rACTN1-GFP + HEK293 (50 ug), Primary dilution: 1:1000-1:2000, Secondary Antibody: HRP conjugated goat anti-rabbit, Secondary dilution: 1:20000.

ACTN1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

ACTN1 Rabbit Polyclonal Antibody

ACTN1 antibody - N-terminal region (orb583986) validated by WB using 1.-2.Rat cortical neurons ctr siRNA (30 ug), 2. Rat cortical neurons ACTN1 siRNA (30 ug) at 1:1000-1:2000.

ACTN1 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

ACTN1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 10 ug ACTN1-GFP transfected COS-7 lysate, Lane 2: 10 ug ACTN2-GFP transfected COS-7 lysate, Lane 3: 10 ug ACTN3-GFP transfected COS-7 lysate, Lane 4: 10 ug ACTN4-GFP transfected COS-7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: ACTN1.

ACTN1 Rabbit Polyclonal Antibody

Sample Type: ACTNX-GFP transfected COS-7 cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-Alexa-Fluor 568, Secondary Antibody dilution: 1:100, Color/Signal Descriptions: Green: GFP Red: ACTN1, Gene Name: ACTN1.

ACTN1 Rabbit Polyclonal Antibody

WB Suggested Anti-ACTN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001093

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ACTN1 Rabbit Polyclonal Antibody (orb583986)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry