ACTN1 Rabbit Polyclonal Antibody

• Catalog Number: orb583986
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACTN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACTN1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 103kDa
• Target: ACTN1
• UniProt ID: P12814
• Protein Sequence: Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
• NCBI: NP_001093
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BDPLT15
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 1.-4. rACTN1-GFP + HEK293 (50 ug), Primary dilution: 1:1000-1:2000, Secondary Antibody: HRP conjugated goat anti-rabbit, Secondary dilution: 1:20000.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

ACTN1 antibody - N-terminal region (orb583986) validated by WB using 1.-2.Rat cortical neurons ctr siRNA (30 ug), 2. Rat cortical neurons ACTN1 siRNA (30 ug) at 1:1000-1:2000.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: 10 ug ACTN1-GFP transfected COS-7 lysate, Lane 2: 10 ug ACTN2-GFP transfected COS-7 lysate, Lane 3: 10 ug ACTN3-GFP transfected COS-7 lysate, Lane 4: 10 ug ACTN4-GFP transfected COS-7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: ACTN1.

Sample Type: ACTNX-GFP transfected COS-7 cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-Alexa-Fluor 568, Secondary Antibody dilution: 1:100, Color/Signal Descriptions: Green: GFP Red: ACTN1, Gene Name: ACTN1.

WB Suggested Anti-ACTN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.