You have no items in your shopping cart.
ACTN1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACTN1 |
| Target | ACTN1 |
| Protein Sequence | Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
| Molecular Weight | 103kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Actinin-α1/2/3/4 rabbit pAb Antibody [orb764468]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μlActinin-α1 rabbit pAb Antibody [orb770735]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μlActinin-α1/2/3/4 Polyclonal Antibody [orb1414760]
IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μlACTN1/ACTN2/ACTN3/ACTN4 Antibody [orb675297]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: 1.-4. rACTN1-GFP + HEK293 (50 ug), Primary dilution: 1:1000-1:2000, Secondary Antibody: HRP conjugated goat anti-rabbit, Secondary dilution: 1:20000.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

ACTN1 antibody - N-terminal region (orb583986) validated by WB using 1.-2.Rat cortical neurons ctr siRNA (30 ug), 2. Rat cortical neurons ACTN1 siRNA (30 ug) at 1:1000-1:2000.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: 10 ug ACTN1-GFP transfected COS-7 lysate, Lane 2: 10 ug ACTN2-GFP transfected COS-7 lysate, Lane 3: 10 ug ACTN3-GFP transfected COS-7 lysate, Lane 4: 10 ug ACTN4-GFP transfected COS-7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: ACTN1.

Sample Type: ACTNX-GFP transfected COS-7 cells, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-Alexa-Fluor 568, Secondary Antibody dilution: 1:100, Color/Signal Descriptions: Green: GFP Red: ACTN1, Gene Name: ACTN1.

WB Suggested Anti-ACTN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
Documents Download
Request a Document
Protocol Information
ACTN1 Rabbit Polyclonal Antibody (orb583986)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review












