Cart summary

You have no items in your shopping cart.

ACTB Rabbit Polyclonal Antibody

Catalog Number: orb577463

DispatchUsually dispatched within 3-7 working days
$ 600.00
Catalog Numberorb577463
CategoryAntibodies
DescriptionRabbit polyclonal antibody to ACTB
TargetACTB
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman, Mouse
Predicted ReactivityBovine, Equine, Goat, Porcine, Rat, Sheep, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human ACTB
Protein SequenceSynthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
UniProt IDP60709
MW42kDa
Tested applicationsIHC, WB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesBRWS1, PS1TP5BP1
NoteFor research use only
NCBINP_001092
ACTB Rabbit Polyclonal Antibody

1. The sample 1 - 8 is used N2 wild type C. elegans. 2. Each lane contain 60 ug of sample and the loading volume is 36 ul. 3. The number 1 sample is a control without any treatment. 4. As I get 50 ug of primary Ab, I diluted with 50 ul of water. I use 5 ul each time in 10 ml of 5% milk in PBST buffer. 5. The secondary antibody for chemiluminescence is Peroxidase-AffiniPure Goat Anti-Rabbit IgG (H+L); for the chromogenic detection, I used goat anti-rabbit IgG-Ap (sc-2007).

ACTB Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

ACTB Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

ACTB Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.

ACTB Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

ACTB Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

ACTB Rabbit Polyclonal Antibody

Sample Type: HepG2 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in HepG2.

ACTB Rabbit Polyclonal Antibody

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

ACTB Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

ACTB Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

ACTB Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

ACTB Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in MCF7.

ACTB Rabbit Polyclonal Antibody

Sample Type: Fetal Lung lysates, Antibody Dilution: 1 ug/ml.

ACTB Rabbit Polyclonal Antibody

IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.

ACTB Rabbit Polyclonal Antibody

Rabbit Anti-ACTB Antibody, Catalog Number: orb577463, Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

ACTB Rabbit Polyclonal Antibody

Sample type: 1-8.N2 WT C elegans (60 ug), Primary Dilution: 1:2000, Secondary Antibody: goat anti-Rabbit HRP, Secondary Dilution: 1:2000.

ACTB Rabbit Polyclonal Antibody

Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: ACTB: Red DAPI:Blue, Gene Name: ACTB.

ACTB Rabbit Polyclonal Antibody

WB Suggested Anti-ACTB Antibody, Positive Control: Lane 1: 30 ug mouse 3T3 ECM extract + blocking peptide, Lane 2: 30 ug mouse 3T3 ECM extract, Lane 3: 30 ug Echinococcus granulosus extract, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:10000.

ACTB Rabbit Polyclonal Antibody

WB Suggested Anti-ACTB Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Transfected 293T.

  • Beta-Actin Rabbit Polyclonal Antibody (Loading Control) [orb500817]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Feline, Fish, Gallus, Guinea pig, Insect, Porcine, Rabbit, Sheep

    Hamster, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 500 μl
  • Actin β Polyclonal Antibody [orb1414761]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Phospho-beta Actin (Tyr53) Rabbit Polyclonal Antibody [orb506128]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • Anti-Gamma-Actin Antibody [orb1879579]

    FC,  IF,  WB

    Human

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Anti-Beta-actin Antibody [orb393034]

    IF,  IH,  WB

    Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 30 μl, 200 μl