You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577463 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ACTB |
Target | ACTB |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Equine, Goat, Porcine, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human ACTB |
Protein Sequence | Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
UniProt ID | P60709 |
MW | 42kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | BRWS1, PS1TP5BP1 |
Note | For research use only |
NCBI | NP_001092 |
1. The sample 1 - 8 is used N2 wild type C. elegans. 2. Each lane contain 60 ug of sample and the loading volume is 36 ul. 3. The number 1 sample is a control without any treatment. 4. As I get 50 ug of primary Ab, I diluted with 50 ul of water. I use 5 ul each time in 10 ml of 5% milk in PBST buffer. 5. The secondary antibody for chemiluminescence is Peroxidase-AffiniPure Goat Anti-Rabbit IgG (H+L); for the chromogenic detection, I used goat anti-rabbit IgG-Ap (sc-2007).
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.
Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.
Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
Sample Type: HepG2 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in HepG2.
Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. ACTB is strongly supported by BioGPS gene expression data to be expressed in MCF7.
Sample Type: Fetal Lung lysates, Antibody Dilution: 1 ug/ml.
IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.
Rabbit Anti-ACTB Antibody, Catalog Number: orb577463, Formalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Sample type: 1-8.N2 WT C elegans (60 ug), Primary Dilution: 1:2000, Secondary Antibody: goat anti-Rabbit HRP, Secondary Dilution: 1:2000.
Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: ACTB: Red DAPI:Blue, Gene Name: ACTB.
WB Suggested Anti-ACTB Antibody, Positive Control: Lane 1: 30 ug mouse 3T3 ECM extract + blocking peptide, Lane 2: 30 ug mouse 3T3 ECM extract, Lane 3: 30 ug Echinococcus granulosus extract, Primary Antibody Dilution: 1:300, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:10000.
WB Suggested Anti-ACTB Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Transfected 293T.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Canine, Feline, Fish, Gallus, Guinea pig, Insect, Porcine, Rabbit, Sheep | |
Hamster, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Other, Primate, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |