You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574385 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ACSL1 |
Target | ACSL1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACSL1 |
Protein Sequence | Synthetic peptide located within the following region: ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY |
UniProt ID | P33121 |
MW | 78kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ACS1, LACS, FACL1, FACL2, LACS1, LACS2 |
Note | For research use only |
NCBI | NP_001986 |
Application: IHC, Species+tissue/cell type:THP-1 derived macrophage activated with iMtb, Primary antibody dilution: Primary ab dil: 1:200, Secondary antibody: Goat anti-rabbit Alexa Fluor 647, Secondary antibody dilution: 1:333.
Application: IHC, Species+tissue/cell type:THP-1 derived macrophage, Primary antibody dilution: 1:200, Secondary antibody: Goat anti-rabbit Alexa Fluor 647, Secondary antibody dilution: 1:333.
WB Suggested Anti-ACSL1 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |