ACSL1 Rabbit Polyclonal Antibody

• Catalog Number: orb574384
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACSL1
• Target: ACSL1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACSL1
• Protein Sequence: Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
• UniProt ID: P33121
• MW: 78kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ACS1, LACS, FACL1, FACL2, LACS1, LACS2
• Note: For research use only
• NCBI: NP_001986

ACSL1 antibody - C-terminal region (orb574384), Catalog Number: orb574384, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

heart, liver, pancreas, brain.

Hum. Fetal Brain.

Human 721_B cells. ACSL1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Human Hela

Human kidney

WB Suggested Anti-ACSL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.