ACHE Rabbit Polyclonal Antibody

• Catalog Number: orb583300
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ACHE
• Target: ACHE
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACHE
• Protein Sequence: Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV
• UniProt ID: P22303
• MW: 61kDa
• Tested applications: IF, IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: YT, ACEE, ARACHE, N-ACHE
• Note: For research use only
• NCBI: NP_056646

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Adult mouse tectum, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Red: Ache Cyan: Nissl(Neurons), Gene Name: ACHE.

Sample Type: Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStop, Primary Antibody dilution: 1:50, Secondary Antibody: Goat anti-rabbit-cy3, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: ACHE: Green Neural crest cells: Red, Gene Name: ACHE.

WB Suggested Anti-ACHE Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.