ACAT2 Rabbit Polyclonal Antibody

SKU: orb324433

Description

ACAT2 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of ACAT2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human ACAT2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACAT2
• Target: ACAT2
• Protein Sequence: Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR
• Molecular Weight: 41kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DI antibody, anti FR antibody, anti SW antibody, anti WD antibody, anti WR antibody, anti AE1 antibody, anti WD1 antibody, anti BND3 antibody, anti EPB3 antibody, anti CD233 antibody, anti EMPB3 antibody, anti RTA1A antibody, anti ACAT2 antibody

Quick Database Links

Gene Symbol

ACAT2

UniProt

Q9BWD1

RefSeq (Protein):NP_005882