You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324433 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC4A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ACAT2 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 41kDa |
Target | ACAT2 |
UniProt ID | Q9BWD1 |
Protein Sequence | Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR |
NCBI | NP_005882 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti DI antibody, anti FR antibody, anti SW antibo Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Positive control (+): Mouse Liver (M-LI), Negative control (-): Mouse Heart (M-HE), Antibody concentration: 1 ug/mL.
Human Liver
WB Suggested Anti-ACAT2 Antibody Titration: 1.0 ug/mL, Positive Control: K562 cell lysate, ACAT2 is supported by BioGPS gene expression data to be expressed in K562.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IP, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |