ACAT2 Rabbit Polyclonal Antibody

• Catalog Number: orb324433
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC4A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACAT2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41kDa
• Target: ACAT2
• UniProt ID: Q9BWD1
• Protein Sequence: Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR
• NCBI: NP_005882
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DI antibody, anti FR antibody, anti SW antibo
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Mouse Liver (M-LI), Negative control (-): Mouse Heart (M-HE), Antibody concentration: 1 ug/mL.

Human Liver

WB Suggested Anti-ACAT2 Antibody Titration: 1.0 ug/mL, Positive Control: K562 cell lysate, ACAT2 is supported by BioGPS gene expression data to be expressed in K562.