You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578907 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Abca7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Human, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 237kDa |
Target | Abca7 |
UniProt ID | Q91V24 |
Protein Sequence | Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
NCBI | NP_038878 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ABCX, Abc5, Abc51 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.
Sample Tissue: Rodent Mouse Testis, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-Abca7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Mouse Liver.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |