ZYX Rabbit Polyclonal Antibody

• Catalog Number: orb329777
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZYX
• Target: ZYX
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZYX
• Protein Sequence: Synthetic peptide located within the following region: GSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEV
• UniProt ID: Q15942
• MW: 61kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ESP-2 antibody, anti HED-2 antibody
• Note: For research use only
• NCBI: NP_003452

Sample Type: HeLa whole cell lysate, Primary Dilution: 1:200. ZYX is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.

WB Suggested Anti-ZYX Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.