You have no items in your shopping cart.
Cart summary
Item 1 of 1
ZNF323 Rabbit Polyclonal Antibody
Catalog Number: orb575778
| Catalog Number | orb575778 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ZNF323 |
| Target | ZSCAN31 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF323 |
| Protein Sequence | Synthetic peptide located within the following region: QEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRC |
| UniProt ID | Q96LW9 |
| MW | 47kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | ZNF323, ZNF310P, ZNF20-Lp |
| Note | For research use only |
| NCBI | NP_665916 |
WB Suggested Anti-ZNF323 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.
- Item 1 of 1
- Item 1 of 1
ZNF323 Rabbit Polyclonal Antibody [orb155450]
ELISA, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 1
- Item 1 of 1
