You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575664 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZP3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Equine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ZP3 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47kDa |
Target | ZP3 |
UniProt ID | P21754 |
Protein Sequence | Synthetic peptide located within the following region: NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGATDLPGQEW |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ZPC, ZP3A, ZP3B, Zp-3, OOMD3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Kidney (KI), Antibody concentration: 5 ug/ml.
WB Suggested Anti-ZP3 Antibody Titration: 0.6 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC-Fr, IHC-P | |
Bovine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |