ZNF93 Rabbit Polyclonal Antibody

• Catalog Number: orb580175
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF93
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF93
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71kDa
• Target: ZNF93
• UniProt ID: P35789
• Protein Sequence: Synthetic peptide located within the following region: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC
• NCBI: NP_112495
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TF34, HPF34, HTF34, ZNF505
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. ZNF93 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

WB Suggested Anti-ZNF93 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate. ZNF93 is supported by BioGPS gene expression data to be expressed in 721_B.