You have no items in your shopping cart.
ZNF81 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF81 |
| Target | ZNF81 |
| Protein Sequence | Synthetic peptide located within the following region: QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGDKPYKCSDCGKGFTQK |
| Molecular Weight | 76kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−ZNF81 Rabbit Polyclonal Antibody (Biotin) [orb2141779]
IHC, WB
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
Biotin
100 μlZNF81 Rabbit Polyclonal Antibody (HRP) [orb2141782]
IHC, WB
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human Liver

WB Suggested Anti-ZNF81 Antibody Titration: 0.5 ug/ml, Positive Control: Jurkat cell lysate.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
ZNF81 Rabbit Polyclonal Antibody (orb573999)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




