ZNF74 Rabbit Polyclonal Antibody

SKU: orb575572

Description

Rabbit polyclonal antibody to ZNF74

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF74
• Target: ZNF74
• Protein Sequence: Synthetic peptide located within the following region: RLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVCGECGKAFRQSSSLTL
• Molecular Weight: 72kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

COS52, hZNF7, ZFP520, ZNF520

Rabbit Anti-ZNF74 antibody, Catalog Number: orb575572, Paraffin Embedded Tissue: Human Brain cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ZNF74 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, ZNF74 is supported by BioGPS gene expression data to be expressed in HEK293T.

Quick Database Links

Gene Symbol

ZNF74

UniProt

Q6PJP1

RefSeq (Protein):NP_003417