ZNF74 Rabbit Polyclonal Antibody

• Catalog Number: orb575572
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF74
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF74
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 72kDa
• Target: ZNF74
• UniProt ID: Q6PJP1
• Protein Sequence: Synthetic peptide located within the following region: RLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVCGECGKAFRQSSSLTL
• NCBI: NP_003417
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: COS52, hZNF7, ZFP520, ZNF520
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-ZNF74 antibody, Catalog Number: orb575572, Paraffin Embedded Tissue: Human Brain cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ZNF74 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, ZNF74 is supported by BioGPS gene expression data to be expressed in HEK293T.