You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575572 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF74 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF74 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 72kDa |
Target | ZNF74 |
UniProt ID | Q6PJP1 |
Protein Sequence | Synthetic peptide located within the following region: RLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVCGECGKAFRQSSSLTL |
NCBI | NP_003417 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | COS52, hZNF7, ZFP520, ZNF520 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-ZNF74 antibody, Catalog Number: orb575572, Paraffin Embedded Tissue: Human Brain cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-ZNF74 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, ZNF74 is supported by BioGPS gene expression data to be expressed in HEK293T.
WB | |
Bovine, Canine, Equine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Human, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Human, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |