Cart summary

You have no items in your shopping cart.

ZNF74 Rabbit Polyclonal Antibody (FITC)

ZNF74 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2133166

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2133166
CategoryAntibodies
DescriptionZNF74 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZNF74
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW72kDa
UniProt IDQ6PJP1
Protein SequenceSynthetic peptide located within the following region: RLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVCGECGKAFRQSSSLTL
NCBINP_003417
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCOS52, hZNF7, ZFP520, ZNF520
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.