You have no items in your shopping cart.
Cart summary
Item 1 of 1
ZNF709 Rabbit Polyclonal Antibody
Catalog Number: orb324632
| Catalog Number | orb324632 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ZNF709 |
| Target | ZNF709 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Canine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF709 |
| Protein Sequence | Synthetic peptide located within the following region: KLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSVCGKD |
| UniProt ID | Q8N972 |
| MW | 75kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti FLJ38281 antibody |
| Note | For research use only |
| NCBI | NP_689814 |
WB Suggested Anti-ZNF709 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
- Item 1 of 2
ZFP872/ZNF709 Rabbit Polyclonal Antibody [orb221964]
WB
Human
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 1
- Item 1 of 1
ZFP872/ZNF709 Rabbit Polyclonal Antibody [orb1816989]
WB
Mouse
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl 
