ZNF683 Rabbit Polyclonal Antibody

• Catalog Number: orb575880
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF683
• Target: ZNF683
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF683
• Protein Sequence: Synthetic peptide located within the following region: PAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQP
• UniProt ID: Q8IZ20
• MW: 55kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Hobit
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_775845
• Expiration Date: 12 months from date of receipt.

Human Intestine

WB Suggested Anti-ZNF683 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.