You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581408 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF681 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF681 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 75kDa |
Target | ZNF681 |
UniProt ID | P59817 |
Protein Sequence | Synthetic peptide located within the following region: PWTRKRHRMVAEPPVICSHFAQDFSPEQNIKDSFQKVTPRRYGKCEHENL |
NCBI | NP_612143 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | FLJ31526 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-ZNF681 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.