ZNF573 Rabbit Polyclonal Antibody

• Catalog Number: orb575844
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF573
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF573
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63kDa
• Target: ZNF573
• UniProt ID: Q86YE8
• Protein Sequence: Synthetic peptide located within the following region: GGHLRIHQRVHTGEKPYKCKECGKTFSRRSNLVEHGQFHTDEKPYICEKC
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: HT1080 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml. ZNF573 is supported by BioGPS gene expression data to be expressed in HT1080.