ZNF528 antibody

• Catalog Number: orb324628
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF528
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF528
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 72kDa
• Target: ZNF528
• UniProt ID: Q3MIS6
• Protein Sequence: Synthetic peptide located within the following region: LTSHQRIHTRERPYGCSQCGKIFSQKSDLIRHRKTHTDEKPYKCNKCGTA
• NCBI: NP_115799
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KIAA1827 antibody, anti MGC126761 antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HepG2 cell lysate tissue using ZNF528 antibody

Western blot analysis of human Fetal Brain tissue using ZNF528 antibody

Western blot analysis of human 293T tissue using ZNF528 antibody