You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575857 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF433 |
Target | ZNF433 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Porcine, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF433 |
Protein Sequence | Synthetic peptide located within the following region: VYGEVGSAHSSLNRHIRDDTGHKAYEYQEYGQKPYKCKYCKKPFNCLSSV |
UniProt ID | Q8N7K0 |
MW | 77kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | FLJ40981 |
Note | For research use only |
NCBI | NP_001073880 |
WB Suggested Anti-ZNF433 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.
WB | |
Canine, Equine, Porcine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Human, Porcine | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Equine, Human, Porcine | |
Rabbit | |
Polyclonal | |
FITC |