You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577291 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF431 |
Target | ZNF431 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF431 |
Protein Sequence | Synthetic peptide located within the following region: MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWE |
UniProt ID | Q8TF32 |
MW | 67kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | DKFZp313E0830, KIAA1969 |
Note | For research use only |
NCBI | NP_597730 |
WB Suggested Anti-ZNF431 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.