You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575677 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF324 |
Target | ZNF324 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF324 |
Protein Sequence | Synthetic peptide located within the following region: WERLLLGSGSGQASVSLRLTSPLRPPEGVRLREKTLTEHALLGRQPRTPE |
UniProt ID | O75467 |
MW | 61kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ZF5128, ZNF324A |
Note | For research use only |
NCBI | NP_055162 |
WB Suggested Anti-ZNF324 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. ZNF324 is supported by BioGPS gene expression data to be expressed in HEK293T.