You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576643 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF282 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF282 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 74kDa |
Target | ZNF282 |
UniProt ID | Q9UDV7 |
Protein Sequence | Synthetic peptide located within the following region: FIRKQNLLKHQRIHTGERPYTCGECGKSFRYKESLKDHLRVHSGGPGPGA |
NCBI | NP_003566 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HUB1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lane 1: 20 ug Bewo cells, Lane 2: 20 ug HEK cells, Lane 3: 20 ug JEG3 cells, Lane 4: 20 ug PC3 cells, Lane 5: 20 ug SHEP cells, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:7500, Gene Name: ZNF282.
WB Suggested Anti-ZNF282 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.
WB | |
Canine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Canine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |