ZNF282 Rabbit Polyclonal Antibody

• Catalog Number: orb576643
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF282
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF282
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 74kDa
• Target: ZNF282
• UniProt ID: Q9UDV7
• Protein Sequence: Synthetic peptide located within the following region: FIRKQNLLKHQRIHTGERPYTCGECGKSFRYKESLKDHLRVHSGGPGPGA
• NCBI: NP_003566
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HUB1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lane 1: 20 ug Bewo cells, Lane 2: 20 ug HEK cells, Lane 3: 20 ug JEG3 cells, Lane 4: 20 ug PC3 cells, Lane 5: 20 ug SHEP cells, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:7500, Gene Name: ZNF282.

WB Suggested Anti-ZNF282 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.