You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576620 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF264 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF264 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 71kDa |
Target | ZNF264 |
UniProt ID | O43296 |
Protein Sequence | Synthetic peptide located within the following region: SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL |
NCBI | NP_003408 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-ZNF264 antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: alveolar cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
WB Suggested Anti-ZNF264 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. ZNF264 is supported by BioGPS gene expression data to be expressed in Jurkat.
IHC, WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |