Cart summary

You have no items in your shopping cart.

ZNF195 Rabbit Polyclonal Antibody (HRP)

ZNF195 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2129216

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2129216
CategoryAntibodies
DescriptionZNF195 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityCanine, Equine, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF195
Protein SequenceSynthetic peptide located within the following region: EWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRKEPWNVK
UniProt IDO14628
MW67kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesHRF1, ZNFP104
NoteFor research use only
Images
Similar Products
Reviews

ZNF195 Rabbit Polyclonal Antibody (HRP) (orb2129216)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet