You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb592931 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ZNF174 |
| Target | ZNF174 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Guinea pig, Rabbit |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF174 |
| Protein Sequence | Synthetic peptide located within the following region: MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFR |
| UniProt ID | Q15697 |
| MW | 46kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | ZSCAN8 |
| Research Area | Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | NP_003441 |

Sample Type: Lane: A. Jurkat, B.HepG2, Antibody Dilution: A. 2.5 ug/ml, B. 2.5 ug/ml.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review