Cart summary

You have no items in your shopping cart.

ZNF167 Rabbit Polyclonal Antibody (Biotin)

ZNF167 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2132666

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2132666
CategoryAntibodies
DescriptionZNF167 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityHuman, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ZNF167
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW85kDa
UniProt IDQ9P0L1
Protein SequenceSynthetic peptide located within the following region: LGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFR
NCBINP_061121
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesZFP, ZNF64, ZNF167, ZNF448, ZSCAN39
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.