You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330053 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZMIZ1 |
Target | ZMIZ1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZMIZ1 |
Protein Sequence | Synthetic peptide located within the following region: MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFE |
UniProt ID | Q9ULJ6 |
MW | 115kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti FLJ13541 antibody, anti KIAA1224 antibody, an Read more... |
Note | For research use only |
NCBI | NP_065071 |
Lanes: Lane 1: 50 ug mouse retina extract, Lane 2: 50 ug mouse prostate extract, Lane 3: 50 ug mouse testis extract, Lane 4: 50 ug mouse colon extract, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:10000, Gene Name: ZMIZ1.
WB Suggested Anti-ZMIZ1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: 293T cell lysate.
FC, IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Bovine, Canine, Equine, Gallus, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
PE/Cy5.5 |