ZMIZ1 Rabbit Polyclonal Antibody

• Catalog Number: orb330053
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZMIZ1
• Target: ZMIZ1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZMIZ1
• Protein Sequence: Synthetic peptide located within the following region: MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFE
• UniProt ID: Q9ULJ6
• MW: 115kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ13541 antibody, anti KIAA1224 antibody, an
• Note: For research use only
• NCBI: NP_065071

Lanes: Lane 1: 50 ug mouse retina extract, Lane 2: 50 ug mouse prostate extract, Lane 3: 50 ug mouse testis extract, Lane 4: 50 ug mouse colon extract, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:10000, Gene Name: ZMIZ1.

WB Suggested Anti-ZMIZ1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: 293T cell lysate.