You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574250 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZKSCAN5 |
Target | ZKSCAN5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Guinea pig, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZKSCAN5 |
Protein Sequence | Synthetic peptide located within the following region: VKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDN |
UniProt ID | Q9Y2L8 |
MW | 97kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ZFP95, ZFP-95, ZNF914, ZSCAN37 |
Note | For research use only |
NCBI | NP_055384 |
WB Suggested Anti-ZKSCAN5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Stomach.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |