You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324715 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Zkscan17 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Sheep |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 66kDa |
Target | Zkscan17 |
UniProt ID | Q5SXI5 |
Protein Sequence | Synthetic peptide located within the following region: GKIFRWRVNFIRHLRSRREQKPHKCSVCGELFSDSEDLDGHLETHEAQKP |
NCBI | NP_766529 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti BC040205 antibody, anti D130067D09 antibody, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-Zkscan17 Antibody Titration: 0.2-1 ug/mL, Positive Control: SP2/0 cell lysate.
IF, WB | |
Human, Mouse, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Porcine, Rabbit, Sheep | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |