Cart summary

You have no items in your shopping cart.

ZFP589 Rabbit Polyclonal Antibody (Biotin)

ZFP589 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2130046

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2130046
CategoryAntibodies
DescriptionZFP589 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZFP589
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW41kDa
UniProt IDQ9Y611
Protein SequenceSynthetic peptide located within the following region: LEIQLSPAQNASSEEVDRISKRAETPGFGAVRFGECALAFNQKSNLFRQK
NCBIAAD38880
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesSZF1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.