Zfp580 Rabbit Polyclonal Antibody

SKU: orb324404

Description

Rabbit polyclonal antibody to Zfp580

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Canine, Guinea pig, Human, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Zfp580
• Protein Sequence: Synthetic peptide located within the following region: ANGVPYTYTVQLEEEPRGPPQREATPGEPGPRKGYSCPECARVFASPLRL
• Molecular Weight: 19 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 1500015O20Rik antibody, anti AI838225 antibody, anti Znf580 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Mouse Mouse Small Intestine, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-Zfp580 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Spleen.

Quick Database Links

Gene Symbol

Zfp580

UniProt

Q9DB38

RefSeq (Protein):NP_081176